PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100015110091
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family HB-other
Protein Properties Length: 273aa    MW: 31753.9 Da    PI: 4.8559
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100015110091genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.32.5e-082162502155
                                   HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                      Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                   + +yp+++++  +A+ +gL+++q+ +WF N+R ++
  Ote100015110091|100015110091 216 QWPYPTEADKIGMAETTGLDQKQINNWFINQRKRH 250
                                   569*****************************885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.1E-174892IPR005540KNOX1
PfamPF037902.3E-195090IPR005540KNOX1
SMARTSM012566.3E-2298149IPR005541KNOX2
PfamPF037912.0E-21102148IPR005541KNOX2
SMARTSM011880.0073170191IPR005539ELK domain
PROSITE profilePS5007112.082190253IPR001356Homeobox domain
SuperFamilySSF466891.15E-17191255IPR009057Homeodomain-like
SMARTSM003891.2E-9192257IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.1E-26195253IPR009057Homeodomain-like
CDDcd000863.89E-12202253No hitNo description
PfamPF059208.1E-17210249IPR008422Homeobox KN domain
PROSITE patternPS000270228251IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MDEMLGVYWR GDEEGLMPPE NLMIPAEYYC DESAASPVNL HEYEEDSSLI KAKISSHPSY  60
SKLLDAYINC QKVGAPPEIE RVLDEIRREK DICKQDDVSM CLGVDPQLDH FMETYCDLLL  120
KYKSDLSRPF HEATSFLTDI QTQLLNLCHG VSWEEEIEIE GAGRKREDEE VKEKLLRMYG  180
NHITSLRLDF SKKKKNGKLP KEATQTLLAW WNMHSQWPYP TEADKIGMAE TTGLDQKQIN  240
NWFINQRKRH WKSPHFDVAN TNNELPHCLQ FDA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071110.11e-106PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS65e-90KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLA0A061EE174e-99A0A061EE17_THECC; KNOTTED1-like homeobox gene 6
STRINGVIT_01s0127g00210.t014e-97(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480